Information

What do “e” “-” “C” and “E” mean in this output?

What do “e” “-” “C” and “E” mean in this output?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

I have given an input of this protein sequence:

MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE

from this website along with the option of COBEpro. Now the output sent by this site to my email is as follows:

Name: temp_prot Amino Acids: MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQPTSQPRGDPTGPKE Predicted Continuous B-cell Epitopes:
MOST LIKELY EPITOPES:
0.82848577 39 TKALGIS CCCCCEE eee-e-e
0.82036375 39 TKALGI CCCCCE eee-e-
0.76503265 38 TTKALGI ECCCCCE eeee-e-
0.73178638 73 TSQPRGDP CCCCCCCC -eeeeeee

and a few more. Now can you tell me, if I consider the very first result, I was able to findTKALGISin the parent sequence but could not findCCCCCEE. What is thisCCCCCEE? And what does thiseee-e-emean?


CCCEEE etc. are the secondary structural elements. In this case, theCrefers to non-strand and non-helix regions i.e loop regions rather than a coiled region. TheCorEusually refers to whether the residue is coiled (C) or part of a strand (E).Hwould be used to denote a helix, however, in the question, it appears that there are no helices. These letters are often different in different software: it's merely a point of semantics between different software.

eor-refers to if the amino acid at that position is exposed or not (-= buried).

For the method, here is the COBEpro paper, although it does seem very technical. The help page has more easily accessible information on the output.


Watch the video: E-Girl vs Soft-Girl. Секреты Школьной Популярности c Одноклассники Forever (September 2022).


Comments:

  1. Palben

    I mean you are not right. I offer to discuss it.

  2. Kilar

    Today I read on this theme much.

  3. Teppo

    Not a bad topic

  4. Zulukree

    In my opinion you commit an error. Write to me in PM.

  5. Cuinn

    The exact answer

  6. Tsekani

    Without much exaggeration, we can say for sure that the post covered the topic 100 percent. :)

  7. Luciano

    What are the correct words ... Super different sentence



Write a message